PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G093900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family G2-like
Protein Properties Length: 360aa    MW: 40344.4 Da    PI: 6.2787
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G093900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.14e-33235290156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Manes.12G093900.1.p 235 KQRRCWSPELHRRFVDALQQLGGSKVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 290
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.555232292IPR017930Myb domain
SuperFamilySSF466898.96E-19233293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-30234293IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-27235290IPR006447Myb domain, plants
PfamPF002494.2E-8237288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MELSLDLGSV YVPKTITEYL REVSKVKDSS QKLSKLDDYV KKLEDEMRKI DAFKRELPLC  60
MLLLNDAIVR LKEEAMQCKK LEDRAEIEVD VSVKEDYSGA DGGNDMRDKK NWMSSVQLWN  120
TGDVNSDSKQ HDSKSETKQR SEEEDDRSTC ENPVQLCNYR SKGGAFMAFK ALPVFDGTGR  180
KEEKEVVSQV TGLSLMTPVS EFGSGNLMSK SNGNIQMKIQ NKPLQQQQQQ PSYKKQRRCW  240
SPELHRRFVD ALQQLGGSKV ATPKQIRELM QVDGLTNDEV KSHLQKYRLH IRKLPASSAA  300
QANGLWMVQD QCKDPSKPTI SQSNSPQGPF HGCGSLKDVS STGGDSIEAE DDDVSESHS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079175.11e-171PREDICTED: uncharacterized protein LOC105639663 isoform X2
TrEMBLA0A067KHZ01e-171A0A067KHZ0_JATCU; Uncharacterized protein
STRINGPOPTR_0007s11470.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-73G2-like family protein